IGF-1 DES 1mg
IGF-1 DES 1mg
Application | A truncated version of IGF-1 in which the tripeptide Gly-Pro-Glu is absent from the N-terminus end of the protein. |
CAS | 112603-35-7 |
Molar Mass | 7365.4225/mol |
Chemical Formula | C319H495N91O96S7 |
Amino Acid Sequence | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA |
Synonyms | Insulin-like growth factor 1, des-(1-3)-, Des(1-3) IGF-1, 4-70-insulin-like growth factor 1 |
Storage | Store in refrigerator at 4°C, tightly sealed, away from heat, light and moisture. |
Solubility | Soluble in water |
Organoleptic Profile | Fine white powder in 3mL glass aliquot |
Composition | Each aliquot contains IGF-1 DES 1mg |
Specification | IGF-1 DES content (per aliquot): IGF-1 DES 1mg |
Terms | This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please click the word Research Chemical to better understand what they are. *RESEARCH CHEMICAL. You should also review our Terms & Conditions. |
This product needs to be reconstituted with bacteriostatic water and is being sold as a research chemical only.
This product needs to be reconstituted with bacteriostatic water and is being sold as a research chemical only.
DISCLAIMER: By purchasing from Wicked Syndicate Research you agree that you are purchasing Research Chemicals which are in no way intended for use in humans.
Wicked Syndicate Research products are furnished for LABORATORY RESEARCH USE ONLY. This product should only be handled by qualified, and licensed professionals. The product may not be used as a drug, agricultural or pesticidal product, food additive or household chemical – and may not be misbranded as such. All information on this website is available for educational purposes only. Bodily introduction of any kind into humans and/or animals is strictly forbidden by law.
*Research Chemicals ARE NOT DIETARY SUPPLEMENTS OR PRESCRIPTION MEDICATIONS THEY ARE *RESEARCH CHEMICALS.
By purchasing from Wicked Syndicate Research you agree that you are purchasing Research Chemicals.
Wicked Labz products are furnished for LABORATORY RESEARCH USE ONLY. This product should only be handled by qualified, and licensed professionals. The product may not be used as a drug, agricultural or pesticidal product, food additive or household chemical – and may not be misbranded as such. All information on this website is available for educational purposes only. Bodily introduction of any kind into humans and/or animals is strictly forbidden by law.
*SARMs ARE NOT DIETARY SUPPLEMENTS.
*Research chemicals are chemical substances used by scientists for medical and scientific research purposes. One characteristic of a research chemical is that it is for laboratory research use only; a research chemical is not intended for human or veterinary use. This distinction is required on the labels of research chemicals, and is what exempts them from regulation under parts 100-740 in Title 21 of the Code of Federal Regulations (21CFR).
Disclaimer: All references to “research subjects” or “test subjects” or and reference to “research” throughout this article refer to research conducted on non human non veterinary research subjects such as rats and mice. If we find that your intent is to use them outside of a legal manner we will no longer sell to you.
DISCLAIMER:All products are for laboratory developmental research use only. Products are not for human consumption.
FDA Disclaimer:The statements made within this website have not been evaluated by the US Food and Drug Administration. The statements and the products of this company are not intended to diagnose, treat, cure or prevent any disease.